PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00050615001
Common NameGSBRNA2T00050615001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 770aa    MW: 86074.1 Da    PI: 5.5167
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00050615001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.82.5e-29506556252
               RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                           k+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  GSBRNA2T00050615001 506 DKNITLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGIQRWPSRKIKKV 556
                          69***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.836495576IPR003035RWP-RK domain
PfamPF020421.2E-25508556IPR003035RWP-RK domain
SuperFamilySSF542772.09E-21662752No hitNo description
Gene3DG3DSA:3.10.20.2402.0E-20669745No hitNo description
SMARTSM006663.8E-24670753IPR000270PB1 domain
PROSITE profilePS5174528.257670754IPR000270PB1 domain
PfamPF005648.8E-19671752IPR000270PB1 domain
CDDcd064072.44E-40671752No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 770 aa     Download sequence    Send to blast
MEDSYLKTDN AVMDTGFMDG LLLDGCWLET TDGSDFLNLT PFDPSSFIWS PTQDTSALVS  60
HMYGQDCAER SSLEDFQWNK RWWIGPGGGA SSVTERLVQA VEHIRDYTTE RGSLIQLWVP  120
VNRGGKRVLT TKEQPFSHDP LCQRLANYRE ISVNYHFSAE QDDSKALAGL PGRVFLGKLP  180
EWTPDVRFFR SEEYPRVQHA QDCGVRGTLA IPVFEQGSKI CLGVIEVVMT TEMVKLRPEL  240
ESICRALQAV DLRSTEVPIQ PSLKGCDLSY KAALPEIQNL LRCACETHNL PLAQTWVSCL  300
QQTKTGCRHN DENYIHCIST IDDACYVGDP TVLEFHEACS EHHLLKGQGV AGQAFLTNGP  360
CFSTDVSNYK KSEYPLSHHA NMFGLHGAVA IRLRCVHTGS ADFILEFFLP KECDDVEEQR  420
KMLDALSSIM AHVPRSLRTV TDKELEEESE VIVTPKIENT LVFDGGDKPN DVFGLKRGYE  480
YKSSESSMFS CGGFSSMAEK KRTKADKNIT LDVLRQYFAG SLKDAAKSIG VCPTTLKRIC  540
RQHGIQRWPS RKIKKVGHSL QKIQRVIDSV ECVSGPLPIS SFYANFPNLT SHEPSQQDKI  600
SPPLPQPLQL SKSPSSSSSQ CCSSGATTDP SQGDVRTGSS LDETVLTLYS LENNPQGGTH  660
LLSSSQDDDS LRIKVSYGEE KIRFRMRDSR RLTDLLWEIG KRFGLEDMSR YDLKYLDEDN  720
EWVLLTCDED VEECVDVCRT TPSHTTIMLL LHVSSHCFPE RSSATGYSL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.265491e-104leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00050615001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0910150.0AY091015.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
GenBankAY1172370.0AY117237.1 Arabidopsis thaliana putative nodule inception protein (At1g20640) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013598530.10.0PREDICTED: protein NLP4-like
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA0A078H2560.0A0A078H256_BRANA; BnaC07g15260D protein
STRINGBra012241.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]